PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400054072
Common NameLOC102582047
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MYB
Protein Properties Length: 245aa    MW: 28864.1 Da    PI: 8.9745
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400054072genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.46.9e-18449147
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                          rg W + Ede+l ++v+++G+++W++Ia  ++ gR++k+c++rw++ 
  PGSC0003DMP400054072  4 RGHWRPHEDEKLRELVAKYGPHNWNAIALNLQ-GRSGKSCRLRWYNQ 49
                          899*****************************.************96 PP

2Myb_DNA-binding551.8e-175699146
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                          r ++T+eE+e+l+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  PGSC0003DMP400054072 56 RSPFTEEEEERLLSSHRIHGNR-WAMIARLFP-GRTDNAVKNHWHV 99
                          789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.795150IPR017930Myb domain
SMARTSM007177.2E-16352IPR001005SANT/Myb domain
SuperFamilySSF466891.12E-29497IPR009057Homeodomain-like
PfamPF002494.9E-17450IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-26557IPR009057Homeodomain-like
CDDcd001673.56E-14748No hitNo description
PROSITE profilePS5129426.33151105IPR017930Myb domain
SMARTSM007175.8E-1555103IPR001005SANT/Myb domain
PfamPF002495.6E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-2158104IPR009057Homeodomain-like
CDDcd001673.12E-65898No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009737Biological Processresponse to abscisic acid
GO:2000652Biological Processregulation of secondary cell wall biogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MCSRGHWRPH EDEKLRELVA KYGPHNWNAI ALNLQGRSGK SCRLRWYNQL DPRINRSPFT  60
EEEEERLLSS HRIHGNRWAM IARLFPGRTD NAVKNHWHVI MSRKCRERSK IYSNRAAQKQ  120
DNNMRKSYID HDQQLLERYS TNCYQFSTTY NSFYPKDKLH FNHVIPRRFN MDQDKNEEVE  180
CYDFLQVNNN TAGSNKSEVI DHIAIRRGTD EEVEQQNGCD NNISSQSKKA PVRFIDFLSV  240
GDSS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-3441057108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00145DAPTransfer from AT1G17950Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754421e-123HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006364393.10.0PREDICTED: transcriptional activator Myb-like isoform X2
TrEMBLM1D2B80.0M1D2B8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000797140.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA17842466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.11e-73myb domain protein 52
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]